PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1720580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 127aa    MW: 14119 Da    PI: 5.3067
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1720580.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB188.74e-5924119297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdrflPianvsrimkk+lPan+kisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplk+yl+kyre+eg
  Lj6g3v1720580.1  24 REQDRFLPIANVSRIMKKALPANGKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKIYLHKYREMEG 117
                      89******************************************************************************************** PP

            NF-YB  96 ek 97 
                      ek
  Lj6g3v1720580.1 118 EK 119
                      98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-5422120IPR009072Histone-fold
SuperFamilySSF471131.29E-4126121IPR009072Histone-fold
PfamPF008081.1E-282993IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-215775No hitNo description
PROSITE patternPS0068506076IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-217694No hitNo description
PRINTSPR006151.5E-2195113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MAESDNESGG QTGGGHTGEL LGCREQDRFL PIANVSRIMK KALPANGKIS KEAKETVQEC  60
VSEFISFITG EASDKCQKEK RKTINGDDLL WAMTTLGFED YVEPLKIYLH KYREMEGEKT  120
GGMVQKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B6e-4924114292Transcription factor HapC (Eurofung)
4g92_B6e-4924114292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238398.14e-76uncharacterized protein LOC100305641
SwissprotO233107e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0B2S2581e-76A0A0B2S258_GLYSO; Nuclear transcription factor Y subunit B-3
TrEMBLI1L0371e-76I1L037_SOYBN; Uncharacterized protein
STRINGGLYMA09G01650.13e-76(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-67nuclear factor Y, subunit B3